INSTRUCTIONS
Case Lot Promotion Presentations
(DeCAForm40-18)
EffectiveOctober01,2012,DeCA’sCase LotPresentationForm(DeCAF40-18)must beused topresent itemsforCaseLotsales. DeCA’sCaseLotPromotionPresentationform(DeCAF40-18)enables vendorstopresentitemsonlyforcaselotsales. Caselotsalesallowcustomerstobuyinbulkorfor selected itemsandto“mixandmatch”products ofsimilarsizeandpricesuchascannedgoods,cereals, andsodasatbulkprices.Allotherpromotionpresentations mustbecompletedusingDeCAPromotion PresentationForm(DeCAF40-16).CaseLotSalepresentationswillonlybesubmittedontheDeCACase Lot PresentationForm(DeCAF40-18).DeCAF40-15will nowbeusedonly for NewItemPresentations
FileMaintenanceRequests.
PresentationsforCaseLotSalesmustuseDeCAF40-18(DeCACaseLotPresentationForm).Formatting hasbeenprotected toallowourscanningprogram toreadandretrievedata.Onlytheinputcellsare unlocked. Youmustcompleteallcellswithbluefieldsbeforesubmitting yourpresentation. Someinput cells–thosehighlightedinyellow–areforthegovernment’s useonly.Donotenteranythingincells highlightedinyellow.ThefollowingisabriefoverviewofeachpageintheDeCAF40-18.
OntheCaseLotPresentationSheetyouwillcommunicate ifyouarepresentingnewitems,listingupto four items, and applicable information regarding the products and details of the promotion. The PromotionPresentation Sheetisalwaysmandatory.Ifyouarepresentingmorethanfouritemsyouwill needtousethePromotionPresentationContinuation pagestopresentuptoamaximumoftwenty-eight (28)items.
IfyouarepresentingnewitemsforCaseLotpromotion,youmustsubmitallnewitemsonDeCA’sNew ItemPresentationform(DeCAF40-15)priortosubmitting yourCaseLotpromotionrequestorwiththe CaseLotpromotion request. Newitemssubmitted withoutaDeCAF40-15onfileorincludedwiththe CaseLotPromotionPresentationformcannotbeconsidered.
Onceyouhavecompletedtheform,physicallysignahardcopyandthen:
•Presentthesignedcopytothebuyer,or
•Digitallyscanthesigneddocument,e-mailthescannedcopytotheappropriatebuyer,or
•Sendthesignedcopybymailorfaxtothebuyer.
Ifyouhaveanyquestionsonfillingouttheform,pleasecontact:
•Donita Higgins
•E-mail:
•Phone:(804)734-8000extension48310.
INSTRUCTIONSFORCASELOTPROMOTIONPRESENTATIONSHEET: Thisformisdesignedto enableyouto presenttheitemsforsalesforaspecificperiod oftimeorforspecific eventsin bulkquantities (typically full cases); howyou plan topromotethe items;basic information about yourcompany;thespecific itemsyouwanttopresent;keyinformationabouttheproductincludingpricing. Thefollowinginformation mustbecompletedonthisformbeforeitcanbeacceptedforconsideration:
PROMOTION PERIOD: Enter the promotion periodyou are recommending based onDeCA’s annual promotioncalendar.
•Select whetheryouaresubmitting theitems forMay CaseLotorSeptemberCaseLot.
•TheNoticeto theTrade (NTT)providingtheannualpromotionalcalendarisposted at ,or
NEWITEM: Ifthisisanewitem beingpresentedaseitheraonetimebuyortobeaddedtoDeCA’scurrent assortment,youmustindicatethisisanewitem,completeandpresentDeCA’sNewItem &FileMaintenance presentationform(DeCAF40-15). SeedoingbusinesswithDeCApageforinstructionsandacopyofthe DeCAF40-15 form(
AVAILABILITY DATE:ForitemscurrentlyinDeCA’sstockassortment,enterthedateproductwillbeavailableto orderfromtheDeCAdistributors bylistingtheday,monthandyear(DD-MM-YY).Ifthisisanewitem,leavethisfield blank.
Ifthisisanewitem,whenthebuyercontactsyou,youwillconfirmthedistributoravailabilitydateforthe productandpromotional quantities,andthebuyerwillpostthedateintheDeCAF40-15toestablishtheinitialpricing periodandontheDeCAF40-16thedateestablishedbythevendorwhenincrementalpromotionalquantitieswillbe availableto shipto thestores.
Ifthisisaseasonalnewitemthatwillbeavailableforworldwidedistribution andbeingofferedasaworldwide promotion,indicatein theremarkssectionwhenyouneedtohavequantitiesfromDeCAtomeettherequireddeliverydate forstoresin EuropeandthePacificTheaterto promoteyouritems.
BROKER: Enterthebroker’snamein30charactersorless—includingspaces. Thebrokeristheofficial representativeauthorizedbythemanufacturerstoact onthemanufacturer’sbehalftofulfillcontractual requirements.
MANUFACTURER:Enterthemanufacturer’snamein32charactersorless, includingspaces. The manufactureristhenameofthe companylistedontheResale OrderingAgreement.
CONTRACTNUMBER: Enterthecurrentcontractnumber(s)inthisspace. Thereisaspecialwaytolist contract numbers. Yourcontract numberbeginswith letters“HDEC”orDECAwhich arethenfollowed by a sequence of numbers(forexample:HDEC0111G9999). Contractnumbersare listed by supplier,vendor number,ordistributorat
•Intheeventyouhavemultiplecontractnumbers(e.g.directstoredeliveryinCONUSandfrequent deliveryforoverseaslocations),listtwocontractnumber(s)forshipmentinCONUSandindicatein the remarks sectionthatother contractnumbers havebeenlistedintheremarks section.
•IfyouareaDSDvendorwithuniquecontractnumbersforselectedstoresinamarketingarea,list yourmaincontractnumbersonthepresentationpage, indicateintheremarkssectionthatadditional contract numbers are listedinthe remarkssection and the applicable DoDAAC (store).
VENDOR NUMBER:Enterthevendor number(identifyingwhich portionof acontract theitemsshould be assigned). Thevendornumbernormallybeginswithaletterfollowedbythreenumbers(e.g.A123)orfour numbers(e.g.1234). Foralistrelating itemstotheircontractandvendornumbergoto
POINTOFCONTACT:Enteryourpointsofcontact(POCs)for.
•VCM:Enteryourpointofcontactinformationincludingname,phonenumberande-mailaddress forthepersonwhowillbereceiving thebillbackcharges forproduct scanned duringthe promotion.Useupto98characters.
•PRICING:EnteryourElectronicDataInterchange(EDI)pointofcontactinformation,including name,phonenumberande-mailaddress.Useupto98characters.
•SALESREP:Enteryoursalesrepresentative’scontactinformation;i.e.,name,phonenumber, ande-mailaddress. Yourcontactshouldbesomeone easytoreachandabletoresolveany questionsorissuesregardingthepromotion.Useupto98characters.
PROMOTIONALDATESANDPRICING: Onceanitemhasbeenacceptedforpromotion,theprice willbelockedforthepromotionalperiodlistedonthisform.Formoreinformationaboutpricelocking, seeDeCA’snoticetothetradeonBusinessRulesforElectronicDataInterchange(EDI)forNational Promotional Pricing.TheNoticetotheTrade(NTT)providingtherelevantannualpromotional calendar datesforeachpromotion hasbeenpostedontheDeCAWEBsiteat as well as the ALA WEB site at datesandpricing forallitems:
•DISPLAYPERIODDATES: Enteryourpreferreddisplaydateshere. Thedateshouldlistday, monthandyear(DD-MM-YY). Forcalendaryear2012,promotionfortheperiodJanuary5th–
18th,2012wouldread05-01-12to18-02-12.
•VPRDATES: SelectRSLOforOcodeditemsandAforallotherRSL’s(K,M,R,T,S,H)Enter theentireperiodyouwillbeofferingthereducedpriceforthispromotion. Thedatesmust includeyourrequestedpromotiondates. Enterthestartandenddatesforthe75or135day Voluntary PriceReduction(VPR)period. DothesameforthesecondRSLandVPRcellsifyou aresubmittingbothOcodeditemsanditemswithanyotherRSLcode.
VOLUNTARYPRICEREDUCTION(VPR)PRICINGMETHOD: Selectthetypeofmethodyou willbeusingtoreduceyourprice.
•OffInvoice: Priceisreducedforallstoreswithinamarketingareaforaspecificperiodoftime consistentwiththerollupperiod(1st– 15thofmonthorthe16th– endofmonth).
•VCM:indicatesyouwillbe markingdownyouritemsusingaVCM
•Both:IndicatesyouwillbereducingyourpricebothoffinvoiceandVCM.
COUPON SUPPORT: Selectwhetherornotyouwillbeusingcasecouponsupport,selectwhetheror notyouwillbeusingitemcouponsupport. Acopyofthecouponcanonlybeshownintheremarks section. Usetheremarkssectionandremarkscontinuations sheetstoenteradditionalinformationif necessary, including photographs of the coupon, distribution and quantity of coupons, expected redemptionrate,andanyotherrelevantinformationregardingyourcouponprogram.
GUARANTEED SALE: Iftheitemsbeingpresentedareguaranteedsales:select“YES;”ifnot,select “NO.” Beforeselectingthisblock,vendorsshouldreviewtheGuaranteedSaleandPriceWarranty clausesinDeCA’sResaleOrderingAgreement(ROA).AROAis availablefromDeCA’sdoingbusiness withindustryWEBsiteat
INSTOREDEMONSTRATIONS:select“Yes”ifyou willbe conductingin-storedemos;ifnot,check “No.”Ifyouselect“Yes,”annotate yourdemoplanintheremarkssectionifapplicable. Identifywhich stores,numberofdemonstrationsperstoreandotherrelevantinformation.
OTHERMARKETINGFUNDS: Indicateifadditionalmarketingfundsareavailable.Annotatehow themarketingfundswillbeused intheremarkssection,anyrequirementstoobtainthesefunds,whenthe funds will be available and how they will be allocated and disbursed. Examples: in-store radio, scholarshipprogram,publications/handouts,orotheroutreachprograms.
PRESENTED/ACCEPTEDFOR:Usethedropdownboxtoindicateeachmarketingareawhereyou plantopromote theitem,orwouldliketheitemadded.Youmayonlyselecttheblocksonthelefthand sideandthebuyerwillindicatetheirdecisionontherighthandsideofthissection.Ifyouarepresenting:
•ForaspecificmarketingareainCONUS(Northeast,Central,Southern,Midwest,Southwestor
Northwest),specifythegeographicareaintheremarkssection.
•ForstorespecificrequestslistthestorelocationsintheDoDAACListingsectiononthe promotionpageorontheRemarkspageifadditionalspaceisneeded.
•IfyouhavestorespecificcontractssubmitthemontheDoDAACpages.
•Forallstoreswithinamarketingarea,listingtheapplicableDoDAAC’sisnotneeded.
PRODUCT INFORMATION: When posting your items, list the top selling line items in descending dollar sales ranking. Each itemhas ten distinct blocks for information:
•Do not entera National Stock Number (NSN); DeCA will assign one.
•Brand (in 15characters or less).
•Nomenclature (in 30 characters and less).
•Minimum ship quantity (by Stock Keeping Unit (SKU)—in other words, the minimum numberofshippingunits—whatevertheshipping unitmight be(e.g.,cases,shippers,pallet modules,etc.)—thedistributoris willingtoshipunderanygivencircumstance).Enter “NA” for entries of shipper or palletmodulecontents.
•Whenpresentingshippersorpallets,entertheshipperorpallet’sinfoinonerowofsub- blocks,thenlisttheinformationforeachitemcontainedwithinthesub-blockrowsthat follow. To show their relationship of a shipper or palletmodule to its contents, refer to the aboveinstructionsforthe“MINSHIPQTY(bySKU)”and “SH/PLTCONTAINS”cellsor see the enclosed example.
•SH/PLTCONTAINS-forashipperorpalletmodule,enterthetotalquantityofsaleableunits (for example: 300 EA) contained within; for the contents of shipper or pallet module—which shouldbe listedasseparatelineitemsfollowingtheshipperor palletmoduleentry—enterthe quantityofsaleable units contained in the shipper or pallet module; otherwise, enter “NA.”
•Casepack(UPK): Forexample,iftheitemhastwelvepackagesinacaselist12,iftheitem is a shipper or pallet the case pack list 1, if the item is randomweight list 1.
•Unit of issue (UI).Use one of the following abbreviations for unit of issue:
BG forbag / CN for can / JR forJar / SH for shipperBO forbottle / CR for carton / KT for kit / TB for tube
BU forbunch / CS for case / LB for pound / TN for tine
BW for bowl / CU for cup / PK for package / TR for tray
BX forbox / EA for each / PL for pallet / TU for tube
-In order for customers to accurately compare the prices of like items, DeCA has standardizedtheunitofissue(UI)usagebased onitems’assignedDIBSDepartment CommodityGeneric Codes (DCG) D/C/G listing—posted on commissaries.com: About Us/BusinessWithDeCA/Marketing;pleaseadheretotheunit ofissueusagelistedfor each DeCA category.
-ForthevaluesinDIBS,goto theDeCApricingWEBsiteif youare notregisteredforthe DeCAWeb PricingSystem; register bygoing to
-Whenpresentinganewitem: reviewthecommoditycodelistingatDeCA’sWEBsiteat Youmayenter a proposedRSL, but the appropriate categorymanager at DeCAwill assign the final RSL.
•NetCTWeight: Listtheweightfortheitembasedontheunitofmeasurelisted. Forexample ifthepackageweighs16ounces,list16inthisfield. Roundthenetweighttothenearest hundredth, e.g. if an item weight 14.752 ounces list14.75.
-If the itemisa randomweight item, list 1.
-Iftheitemisashipperlistthecount,EXAMPLE:ifashippercontains20ofone item, 30 of a second item and 25 of a third item, list 75 as the net content.
-Foritemsnotmeasuredbytheounce(OZ),listtheappropriatequantity.Example:for box of razorblades containing 48 blades,youwould list 48.
•UnitofMeasure:Inorder forcustomerstoaccuratelycomparethepricesoflikeitems,DeCA hasstandardizedunitofmeasure’s(UOM’s)basedonitems’assigned DIBS Department CommodityGeneric Codes (DCG). A DCG Listing attachment has been posted alongside the DeCAF40-16andtheseinstructions.PleaseusethestandardizeUOM fortheapplicable departmentcommoditycodeUnitofmeasure(UOM). Use one ofthefollowingabbreviations for unit of measure:
-BU forBunch-for Produce
-CT for Count-for multipack items (e.g., razor blades)
-DZ for dozen-for eggs
-EA for each
-FT for feet-for itemsmeasured in linear feet (e.g.,dental floss)
-IN for inch-for tape
-LBforpound-followthefivepoundruleofthumb:groceryitemsthatweighfiveor more pounds are generally measured in pounds (e.g., dog food, random weight items); items that weigh less than fivepounds aremeasured in ounces.
-OZ for ounce-metricmeasurement aren’t used in CONUS
-PR for pair-for latex gloves
-SFforsquarefoot-forallitemsmeasuredinsquarefeet(e.g.,papertowels,aluminum foils, facial tissues)
SHIPPINGLEVEL(CASE)GLOBALTRADEIDENTIFICATIONNUMBER(GTIN). Enterall
14digitstoidentifytheproductontheshelf.Donotenteranyspacesorseparationmarks. TheGlobal TradeIdentificationNumber(GTIN)isauniquenumberusedtoidentifyproducts,innerpacksorsleeves, cases,shippers,andpallets.See detailsregardingGTIN’s.
CONSUMERLEVEL(ITEM)GLOBALTRADEIDENTIFICATIONNUMBER(GTIN).Enterall
14digitstoidentifytheproductontheshelf.Donotenteranyspacesorseparationmarks. TheGlobal TradeIdentificationNumber(GTIN)isauniquenumberusedtoidentifyproducts,innerpacksorsleeves, cases,shippers,andpallets.See detailsregardingGTIN’s.
ITEMUNIVERSALPRODUCTCODE: Enter 11digits. Entertheleaddigit;(thedigitprecedingthe barcode);enterthetenfollowing digits;butdonotenterthecheckdigit(thedigitthatfollowsthebar code).Azerowillautopopulate theendposition astheDeCAcheckdigit.Donotenteranyspacesor separationmarks.
EXAMPLES:
Thisisthe10digitUPC.Thisisthe10digitUPC.
Thisistheleaddigit(include).Thisisthecheckdigit(donotinclude).Thisistheleaddigit(include).Thisisthecheckdigit(donotinclude).
ThisitemUPCwouldbeenteredas:98765432109.ThisitemUPCwouldbeenteredas: 01234567890.
TheUPCwillpopulateinthecellwiththisformat:TheUPCwillpopulateinthecellwiththisformat:
987654321090012345678900
CASEUNIVERSALPRODUCTCODE:Enter11digits.Entertheleaddigit;enterthetenfollowing digits;butdonotenterthecheckdigit.AzerowillautopopulatetheleadpositiontocreatetheDeCA CUPC.Donotenteranyspacesorseparationmarks.
EXAMPLES:
Thisisthe10digitUPC.Thisisthe10digitUPC.
Thisistheleaddigit(include).Thisisthecheckdigit(donotinclude).Thisistheleaddigit(include).Thisisthecheckdigit(donotinclude).
ThisitemUPCwouldbeenteredas:98765432109.ThisitemUPCwouldbeenteredas:01234567890.
TheUPCwillpopulateinthecellwiththisformat:TheUPCwillpopulateinthecellwiththisformat:
098765432109001234567890
DeCAPACKAGE COST: Youwillneedtoconfirmfortheconsumerunit(package)yourregular andpromotionalpricing.
•CONSUMERUNITREGEDIPRICE: IntheRegularEDIcostfield,enterthemostrecent regularEDIpricefortheconsumer sellingunit(package) senttoDeCA.Regularcostisthe highest customerpricechargedDeCA overthelast52weeks. Thispricemustalsobeutilizedas theregularcostonanyindustryprovidedDeCAsignage.VendorsareremindedDeCAhasa price warrantyclauserequiringtheaverageofallpriceoffersmadeoveracalendaryear(1January–
31December)bythevendorforallproductscoveredundertheresaleorderingagreementshallbe aslowasorlowerthanthoseoffersmadetosupermarketsintheUnitedStatesundersimilar termsandconditions.
•CONSUMERUNITOFFINVOICE(VPR)EDIPRICE: Intheoffinvoicecostfield;enterthe lowestpriceyouarewillingto offeroffinvoicefortheconsumersellingunit (package).Youwill transmitthisoffinvoicepriceusingElectronicDataInterchange(EDI). Theoffinvoiceprice mustbefortheentirepricingperiodlisted.
•CONSUMERUNIT+1%: Thisisthepricethecustomerwillseeontheshelf. Thepricewill automaticallybecalculatedandrepresentstheconsumerunitVPRpriceplusa1%recoup.
•DonotenteranythingintheVPR%field;oncedataisenteredintothetwoprecedingfields,it willauto-populatewiththepercentageofsavingsovertheitem’sregularcost.
DeCA CASECOST: The worksheet willautomatically calculatethefollowing:
•REGULAREDIPRICE(FORCASE); IntheRegularEDIcostfield,themostrecentregularEDI pricefortheshippingunit(CASE)senttoDeCAisautomaticallycalculated.Regularcostisthe highestcustomerpricechargedDeCAoverthelast52weeks. This pricemustalsobeutilizedasthe regularcostonanyindustryprovidedDeCAsignage.VendorsareremindedDeCAhasaprice warrantyclauserequiringtheaverageofallpriceoffersmadeoveracalendaryear(1January–31
December)by the vendorforallproducts covered under theresale ordering agreementshall be aslow asorlowerthanthoseoffersmadetosupermarketsintheUnitedStatesundersimilartermsand
conditions.
•VPR PRICE (FOR CASE): Do not enteranythingis thisfield. Intheoffinvoicecostfield,thelowest priceyouare willingtoofferoffinvoicefortheshippingunit(CASE)willautomatically becalculated basedontheinformationyouhaveprovided. Youwillneedtotransmitthisoffinvoicepriceusing ElectronicDataInterchange(EDI). Theoffinvoicepricemustbefortheentirepricingperiodlisted.
STORELEVELREDUCTIONS: Inadditiontoreducingthepriceoffinvoice,suppliershavetheoptionto offeradditionalsavingsby reducingthepriceatstorelevel:
•VPRPRICETOTAL(FORCASE): Donotenteranything inthisfield. Thevoluntaryprice reductioncost(VPRCOST)fieldthepromotionpricebeingoffered fortheshippingunit(CASE)will automatically becalculatedbasedontheinformationyouhaveprovided. Ifthisisanew item presentationandyouareofferingan“everydaylowprice”butwanttohavetheitem featuredon promotion this spaceshould be left blank.
•VCMTOTAL(FORCASE): Enterthe additional amountyouwillreducethecasecostatstorelevel.
•VCMCOST+1%RECOUP(FORCASE): Donotenteranythinginthisfield.Thevaluewill automaticallybecalculated and representsthe consumerunitVPRpriceplusa1%recoup.
•PERCENTAGESAVINGS: DonotenteranythingintheVPR%field;oncedataisenteredintothe precedingfields,itwillauto-populatewith the percentageofsavings overtheitem’sregularcost.
FINALCASECOSTBASEDONCOUPONAMOUNTANDLEVELOFVPR’S: Youwill needtoconfirm yourfinal casecosttoDeCAforthispromotionbasedthevalueofcoupons youwill provide each store aswell as the method(s)you selected to reduce your pricefor the case lot sale:
•COUPONOFFER(FORCASE): Ifyouareprovidingacoupontoreducethesaleatstore level, enter the coupon value in this block for the total value of the coupon. Provide a picture ofthecouponintherequiredareaontheform andindicateintheremarkssectionthenumber of coupons to be allocated to each store
•VCMAMOUNT (FORCASE):Value will be calculated automatically.
•FINAL PRICE (FOR CASE):Value will be calculated automatically.
•% SAVINGS: Value will be calculated automatically.
PATRONSAVINGS,PACKAGESALES,DOLLARSALES. Enterthepackagesales.Patron savings anddollar saleswill calculate automatically. The following are the definitions for:
•PATRONSAVINGS: Donotenter. Thiswillbeautomaticallycalculatedbytakingthe difference between the DeCA and retail price times the total package sales to determine the total savingsfor a specificperiod of time.
•CASESALES: Totalnumberofpackagesyouexpectwillbesoldonlyfortheapplicable displayperiodeventhoughthepromotionmaybeofferedforalongerperiod oftime. If you want to list the quantityfor the entire applicable displayperiod, list your projections in the remarks and indicate theperiod of time.
•DOLLARSALES: Totaldollarsyouexpectwillbesoldforthesameperiodoftimeusedfor package sales.
Regional Stockage List(RSL) andDepartmentCommodityCode (DCG).
This block has two distinct input cells:
•Enter the Region Stock Listing (RSL)code.
•Do not enterthe Department CommodityCode (D/C/G) the buyer will assign it.
•For the values currentlyinDIBS, go to or the DeCApricing WEB site (NOTE: If you arenot registered for the DeCA WebPricing System, youcan registerby going to
•When presenting a solely new item: review the commoditycode listing at You mayenter an RSL proposal on the New ItemPresentation Form(DeCAF 40-15) and this Promotion Presentationform, but the RSL will bedetermined and assignedbythe appropriate DeCA categorymanager.
•Do not enterthe plan-o-gramnumber the buyer willassign it.
•When making a regional or store specific presentation, make an annotation to that effect on the REMARKS page.Identifythe specific marketing area and/or stores.
SH/PL $: Do not enter.This will be automaticallycalculatedwhen the presentation is for shippers or pallets and their contents. This cell will calculate thesumof the pricemultiplied bythe number of units for each item.
CASE CUBE: Round tothe nearest hundredth (e.g. 21.232would be 12.24,3.56, etc.). CASE WEIGHT: Round to at least the nearest hundredth (e.g.21.23, 3.56,etc.). PALLET TIE: List the number of cases per layer.
PALLET TIER: List thenumber of layers per pallet.
CIVILIANCOST: Thisblock has four distinct input cells. Enter average civilian pricing as follows:
•In the “REGE” field, enter the average non-promoted price for the East Coast civilian market.
•In the “REGW” field, enter the average non-promoted price forthe West Coast civilian market.
•In the “PROMO E” field, enter the average promoted price for the East Coast civilianmarket.
•In the “PROMO W”field, enter the average promoted price for the West Coast civilian market.
•The Mississippi River demarcates thedividing line between theEast and West Coasts. Enter data fromthemost recenttwelve (12)month period.
SAVINGS:Do not enteranything in the “Savings” fields; the percent savings over retail will automaticallybe calculated (including the 1% DeCA recoup)based uponwhat you input in the other
fields regarding pricing.
DIBS PRICE LOOK UP (PLU): Leave this block blank. It is for the government’s use only.
BUYERS NOTES: Leave this blockblank. It is for the government’suse only.
REMARKS:
•Ifapplicable,enternationalmediadatesintheappropriatefield(TV,Radio,Sampling,or Other). Enter additional media date information (market reach, frequency, audience demographics, etc.) in the remarks section if applicable.
•Indicatethetypeofcouponsupportyouwillbeproviding(National—orregional—FSI,In- store on Shelf, or In-storeon Flyer).
•Enteradditionalinformationifnecessary,includingphotographsofthecoupon,quantityby store class (when applicable), distribution, frequencyof coupon and anyother relevant information.
•Indicateifadditionalmarketingfundsareavailable.Annotatehowthemarketingfundswill beusedontheRemarkssheet,orononeoftheremarkscontinuationsheet.Examples:in- store radio, scholarship program, publications/handouts, or other outreach programs.
•Ifyouwillbeconductingin-storedemonstrationsannotateyourdemoplanincludingwhich stores, number of demonstrations per store and other relevant information.
•Anyrelevantinformationyoufeelwillhelpthebuyerunderstandthefeaturesandbenefitsof your products.
•Pictures of products orshippers maybe placed only in the section assigned for pictures.
•Ifyouwishtohaveitemsconsideredforinclusioninthe“MixMatch”portionofthecase lotsaleindicatetheitemsyouwould liketo have in the“Mix & Match” program in the remarks section.
SALESREPRESENTATIVESIGNATURE: Whenyousignthisblock,youarestipulatingthat allinformationyou’veenteredisaccurateand acknowledgingthat youaresigningalegallybinding agreement on behalf of the manufacturer listed onthe DeCAF40-18.
•Thisformisalegallybinding,contractualagreementandparticipatingpartieswhohave signed this form are expected to follow through with their entered commitments. A minimumof60daysnoticeisrequiredtodeviatefrom thiscommitment.“Themanufacturer voluntarilyagreestotheDeCAdeleteprocess,includingdispositionofexcessquantitiesafter
90 days.”
•Bysigningthisform,vendoragreestotaketheappropriateactionwhenanitemisidentified fordeletions,addressing residualinventories inthedistributor,andfollowingthedelete processintheeventanitem failstomeeteitherthemanufacturer’svolumeprojectionsor the minimumcategoryrequirementsestablishedbythe buyer. Themanufactureralsoagreesthat theitem shouldsupport areasonablerelationshipbetweennormalturnvolumeandthe distributor minimumshipquantityby distributor location.”
•ThevendoragreesthatDeCAhasnoresponsibilitytosellremaininginventoryafter30days from theendingdateofthecaselotsaleandproductmaybereturnedtovendoratthe discretion ofDeCA.
BUYERAND LINEITEMMANAGERSIGNATURE:Leave thissectionblank, itisforDeCA’suse only. Oncethebuyerhasapprovedanitemforapplicable stores,storeswillidentifytheirprojected quantitiesforthepromotion withtheassistance ofindustry,ordersplacedbythestoreandproducts displayedduringtheapplicablepromotionalperiod.
SPECIALREMINDERS:
• Thisformcannot bechangedor alteredinanymanner.
•Besides the sales representatives signature (Sale Representative Signature, printed name, and phone number) onthe promotion presentation pageshandwriting onthe formby industry is NOT permitted.
• Youmust fill out at least all bluefieldsbefore submittingyourpresentation.
• By signingthis presentation formthe supplier and theirrepresentativesaswell asDeCAare committingto:
oInsuringproductsselectedwillbeorderedbystores,shippedinthequantitiesrequested,and effectively merchandised on the shelfon a timely basis.
oTaking appropriate action when an item is identified for deletion and addressing residual inventories in thedistributor.
oAcknowledgingpresentationwill only beprocessedifallrequiredinformationhas beencompleted and certified by the vendor ortheirrepresentative.
• Ifyouhaveanyquestionsregardinghowtocompletethisform,contactDonita Higgins or phone (804) 734-8000, extension 48310.
Attachments:
1. CaseLotPromotionPresentationForm–DeCAF40-18
2. SampleCaseLotPromotionForm–Offinvoiceonly
3. SampleCaseLotPromotionForm– VCMonly
4. SampleCaseLotPromotionForm–BothoffinvoiceandVCM
5. SampleCaseLotPromotionForm–Pallet
